Protein Labeling Reagents
![eMolecules Broadpharm / BDP TR X NHS ester / 1mg / 761705583 / BP-28885 / 98.000 / 197306-80-2 / [null] / 634.460 / C31H29BF2N4O6S](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502459511.PNG-250.jpg)
eMolecules Broadpharm / BDP TR X NHS ester / 1mg / 761705583 / BP-28885 / 98.000 / 197306-80-2 / [null] / 634.460 / C31H29BF2N4O6S
Broadpharm / BDP TR X NHS ester / 1mg / 761705583 / BP-28885 / 98.000 / 197306-80-2 / [null] / 634.460 / C31H29BF2N4O6S
Medchemexpress LLC HY-D0938 5mg Medchemexpress, CFSE CAS:150347-59-4 Purity:>98%
Medchemexpress, HY-D0938 5mg CFSE CAS:150347-59-4 CFSE is a fluorescent dye which can track the cell division. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
AnaSpec B AMYLOIED (1-40) HILYTE FLUR
Beta-Amyloid (1-40), HiLyte(TM) Fluor 488-labeled, Human[HiLyte(TM) Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4686.3; (0.1 mg) This is a fluorescent (HiLyte(TM) Fluor 488)-labeled B-Amyloid peptide, Abs/Em=503/528 nm.
Medchemexpress LLC HY-D0827 5mg Medchemexpress, CY2 (Non-Sulfonated) CAS:260430-02-2 Purity:>98%
Medchemexpress, HY-D0827 5mg CY2 (Non-Sulfonated) CAS:260430-02-2 CY2 Non-Sulfonated (Cyanine2) is a dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC HY-D0822 5mg Medchemexpress, CY3 CAS:146368-13-0 Purity:>98%
Medchemexpress, HY-D0822 5mg CY3 CAS:146368-13-0 Cy3 (Sulfo-Cyanine3) is an orange-fluorescent label for protein and nucleic acid (λ ex =554, λ em =568). Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC HY-D0821 5mg Medchemexpress, CY5 CAS:146368-11-8 Purity:>98%
Medchemexpress, HY-D0821 5mg CY5 CAS:146368-11-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
eMolecules Medchem Express / 5(6)-ROX / 5mg / 415688918 / HY-D0043 / / 198978-94-8 / MFCD29912920 / 1069.224 / C66H60N4O10
Medchem Express / 5(6)-ROX / 5mg / 415688918 / HY-D0043 / / 198978-94-8 / MFCD29912920 / 1069.224 / C66H60N4O10
![eMolecules Broadpharm / Sulfo-Cy75 azide / 1mg / 761705660 / BP-28907 / / / [null] / 1165.500 / C48H51K3N6O13S4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502459346.PNG-250.jpg)
eMolecules Broadpharm / Sulfo-Cy75 azide / 1mg / 761705660 / BP-28907 / / / [null] / 1165.500 / C48H51K3N6O13S4
Broadpharm / Sulfo-Cy75 azide / 1mg / 761705660 / BP-28907 / / / [null] / 1165.500 / C48H51K3N6O13S4
Bioworld Protein-A Gold™ (5-10 nm), 1 mL
Protein-A Gold Protein-A is a highly stable cell surface receptor produced by several strains of Staphylococcus aureus. It is capable of binding to the Fc portion of immunoglobulins, especially IgG from a large number of species. Protein-A may be conjugated with various reporter molecules, including colloidial gold, without affecting the antibody binding site on the molecule. Specifications:Particle size5-10 nm (monodisperse), nominal 15 nm (colloidal gold) Suspension in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin, 20% glycerol, and 15 mM sodium azide. Storage: 2-8 C
Lumiprobe Sulfo-Cyanine5 NHS ester, 2230212-27-6, 1mg
Molecular formula: C36H40N3KO10S2, Molecular weight: 777.95, Appearance: dark blue powder, Solubility: very good in water, good in DMF and DMSO; Water-soluble red emitting fluorescent dye. Amine-reactive Cy5 analog for the labeling of proteins/peptides and amino-oligonucleotides.
Cayman Chemical BIotIn-X-NHS 100mg
A compound used to attach biotin to primary amines, such as those found on lysines on the surface of proteins; contains six-atom spacer arm